PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2414s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 280aa    MW: 30942.6 Da    PI: 7.0175
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2414s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.6e-4054112462
                  zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              alkcprCds++tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  SapurV1A.2414s0010.1.p  54 LALKCPRCDSAHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 112
                             5789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2846106IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3355110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.07856110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGLTSLQVCM DSSDHWLQGT INEESGMDSS SPSGDMITCS RPLMERRLRP PHDLALKCPR  60
CDSAHTKFCY YNNYSLSQPR YFCKTCRRYW TKGGTLRNIP VGGGCRKNKK VSKKSNDQSV  120
NQMNPGSSSS HNPTDLHLSF PEVQFSHLNN ILDSQGTIAT SNFMDSNYNI SMLENPRPID  180
FMDSKLEALA GSSRNYDFMG NGDLSMVSGL GDMSHHHGLA PNYSGLCSPF GTSLDGNSGT  240
FMENCQRLML PYGQGNNDQH GIDVKPNTKL LSLDWQDQG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001532.10.0PREDICTED: dof zinc finger protein DOF5.6
SwissprotQ9FM031e-52DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLB9I3A60.0B9I3A6_POPTR; Uncharacterized protein
STRINGPOPTR_0012s08280.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.12e-51Dof family protein